Donkeys and Elephants and Delegates,oh my!
Check out the most popular
Your Password Must Be at Least 17,145 Characters
support.microsoft.com — A genuine Microsoft Knowledge Base article about a particularly strange error message some people have received on Windows 2000. Never fear though, SP1 fixes these problems! Well, sort of... "Note that the number of required characters changes from 17,145 to 18,770 with the installation of SP1"
moojj- 966 diggs
- digg it
- openthink, on 10/10/2007, -0/+33guess that rules out your home telephone # backwards....
- EmileVictor, on 10/10/2007, -1/+5By the way, I was just about to ask you for that.
- stryker2you, on 10/10/2007, -1/+4I use my ATM pin number...its 3862.
- rebrad, on 10/10/2007, -0/+2I'm glad that I still use CP/M 86, I don't have those kind of problems that these newer bloated operating systems have. Give me 4k and an 80k 8 inch floppy and I'm up and running.
- nevetsg, on 10/10/2007, -1/+38 inch floppy?? respect.
- Amnesia10, on 10/10/2007, -0/+3"guess that rules out your home telephone # backwards...."|
Not if you are ET. His number must be huge. - Tenoq, on 10/10/2007, -0/+1How many HD-DVD devices keys is that, exactly?
09-F9-11.....
- EmileVictor, on 10/10/2007, -1/+5By the way, I was just about to ask you for that.
- randysouth, on 10/10/2007, -2/+52No problem.... if you're Commander Data.
- mdeppi01, on 10/10/2007, -7/+6I think you mean "if you are Commander Data"...
- RobertJoseph17, on 10/10/2007, -1/+2I think that's what he said.
- kurocrow, on 10/10/2007, -0/+3Mdeppi's joke was that Data can't use contractions. Thus "you are" and not "you're".
Also, 1-7-3-4-6-7-3-2-1-4-7-6-Charlie 3-2-7-8-9-7-7-7-6-4-3-Tango 7-3-2-Victor 7-3-1-1-7-8-8-8-7-3-2-4-7-6-7-8-9-7-6-4-3-7-6-Lock. :D- mdeppi01, on 10/10/2007, -0/+1Thanks for not being dumb.
- kurocrow, on 10/10/2007, -0/+3Mdeppi's joke was that Data can't use contractions. Thus "you are" and not "you're".
- RobertJoseph17, on 10/10/2007, -1/+2I think that's what he said.
- mdeppi01, on 10/10/2007, -7/+6I think you mean "if you are Commander Data"...
- idc5, on 10/10/2007, -1/+51well this would prove useful for the guy who set the record for most digits memorized for PI
- dhess, on 10/10/2007, -0/+35I don't think that he would have any problems memorizing his password then... but I've got a pretty decent guess as to what it would be. =)
- capiCrimm, on 10/10/2007, -1/+17i don't care if you know it, try ***** typing that in.
Security through "***** I'm starting to hallucinate"
- capiCrimm, on 10/10/2007, -1/+17i don't care if you know it, try ***** typing that in.
- dhess, on 10/10/2007, -0/+35I don't think that he would have any problems memorizing his password then... but I've got a pretty decent guess as to what it would be. =)
- wiifm69, on 10/10/2007, -0/+16Microsoft are just future-proofing, thinking ahead to the year 3048
- GerryBot, on 10/10/2007, -0/+12Yeah, but they've got the Y3K bug to contend with first...
- Giga, on 10/10/2007, -0/+2At least they don't have to worry about the epoch bug.
- GerryBot, on 10/10/2007, -0/+12Yeah, but they've got the Y3K bug to contend with first...
- Matt-lars, on 10/10/2007, -3/+74*****.. and just when I came up with a good one that was 17,144 characters long..
- arkaycee, on 10/10/2007, -0/+2I had that problem.... and my boss got mad at me when I just put a 1 after it, then a 2 after it three months later. Much too guessable.
- seanherman, on 10/10/2007, -0/+8I think there's a bigger problem in play if your boss is regularly chatting you up about your password
- arkaycee, on 10/10/2007, -0/+2I had that problem.... and my boss got mad at me when I just put a 1 after it, then a 2 after it three months later. Much too guessable.
- schestowitz, on 10/10/2007, -33/+9This is as brilliant as this new screenshot from Vista (seriously): http://img358.imageshack.us/img358/4755/1002398ii4.jpg
- dsendecki, on 10/10/2007, -0/+30Isn't that the bios, rather than the OS throwing that error?
- schestowitz, on 10/10/2007, -0/+1Yes, I know, but the person who posted this photo (in Digg) said the PC was running Vista and there no way for you to tell if it's just a DOS session with a fake BIOS-like error. If I post you the link to the person who posted this photo, make fun of him/her.
- Krumm, on 10/10/2007, -0/+21That's been available on many PC's since BIOS was invented!
Whoever is touting this as a Vista bug must be running out of ideas... - Mapeki, on 10/10/2007, -1/+7Thats so if you plug your keyboard in afterwards....
- STKD, on 10/10/2007, -0/+7Yes but he probably won't let that stop another lame Microsoft bashing attempt...
- Mapeki, on 10/10/2007, -0/+8Its at boot, its so if your keyboard isn't working you can plug in another/fix it.. what ever and keep going by pressing F1.. Wow, that is stupid...
- Mapeki, on 10/10/2007, -10/+3Its at boot, its so if your keyboard isn't working you can plug in another/fix it.. what ever and keep going by pressing F1.. Wow, that is stupid...
- Mapeki, on 10/10/2007, -13/+2Its at boot, its so if your keyboard isn't working you can plug in another/fix it.. what ever and keep going by pressing F1.. Wow, that is stupid...
- DrDigg, on 10/10/2007, -0/+5Third posts a charm
- KingBabi, on 10/10/2007, -4/+1That's been around for a long time (the error, not the photo itself). I remember it being a problem with my IBM Model M after it broke (gasp!) on Win98.
Not that it still isn't hilarious.- GMorgan, on 10/10/2007, -1/+7An obvious lie. The Model M doesn't break, ever. Take your heresy to someone less gullible.
Only one thing could ever break a Model M but you've obviously had no contact with Chuck Norris since you're alive to make that post.- KingBabi, on 10/10/2007, -0/+1I said gasp for a reason. I had spilled coke on it, and despite the drain holes in the bottom it still broke.
- GMorgan, on 10/10/2007, -1/+7An obvious lie. The Model M doesn't break, ever. Take your heresy to someone less gullible.
- knobidy, on 10/10/2007, -3/+1That has been around for a long, long time.
Still funny though. - charityjustice, on 10/10/2007, -0/+5shestowitz = retard or troll (seriously)
- Philluminati, on 10/10/2007, -0/+4schestowitz is a microsoft basher: http://groups.google.co.uk/group/comp.os.linux.advocacy/topics?lnk=gschg
- daok, on 10/10/2007, -0/+7schestowitz if we start to do screenshot of all Linux problems too we will be there for a long time too. Stop bashing.
- nakile, on 10/10/2007, -8/+2Looks more like a Adobe® Photoshop® error to me...
- LastVisibleDog, on 10/10/2007, -0/+2So now brain-dead Windows Haters / Bed-wetters think bios errors are Windows Vista errors - no wonder you hate Windows, you are computer-illiterate.
- dsendecki, on 10/10/2007, -0/+30Isn't that the bios, rather than the OS throwing that error?
- ApolloXLII, on 10/10/2007, -14/+2i'd just hold down the letter a for about 30 minutes... and presto!
...just make sure i hold it down for the same out of time from there on.
and it better be a password that holds access to pics of kiddy porn that hasn't happened yet.- Xanium4332, on 10/10/2007, -2/+7your post was funny all the way to about the last line, where you ruined it.
- rebopper, on 10/10/2007, -0/+5Yep, the last line of your comment made it so uncool, man. Seriously, WTF did you even mean by that?
- simpleid, on 10/10/2007, -0/+3some people have no tact
- Synapse84, on 10/10/2007, -2/+20only 17,145? pft... my password is over 20,000 and it takes me 4 hours to type it and logon.
- link470, on 10/10/2007, -0/+7That would seriously suck when you get the message "you're password is incorrect, please try again" after 4 hours :P
- Alystair, on 10/10/2007, -0/+1It must really suck when you go for a coffee, and your screen saver turns on, locking you out again.
- Speedy7, on 10/10/2007, -0/+23Meh, My Digg password is longer than that... By the time i've finished writing it in, the story i needed to digg is around the 50th page...
- digggggggggg, on 10/10/2007, -1/+1hrm, why don't we just add more g's to my username?
- xero69, on 10/10/2007, -8/+3I wish I could force this error to show up on my bosses Windoze box
- stryker2you, on 10/10/2007, -0/+3Yeah, the same way he will "force an error" on your paycheck...or delete you from the company employee list....file not found.
- jetskidude911, on 10/10/2007, -1/+11It would kind of suck if you forgot your password.
- ufia, on 10/10/2007, -0/+19I ran out of post-it notes.
- AMSRay, on 10/10/2007, -12/+3Did anyone notice the name of the file that provides the fix?
Date Time Version Size File name
------------------------------------------------------
03/08/2001 06:43p 5.0.2195.3351 331,536 Msgina.dll
Msgina.dll? Okay, Deuce Bigalow had a mangina, so Microsoft has a msgina?- zwaldowski, on 10/10/2007, -3/+15How old are you?
- TJacques, on 10/10/2007, -1/+26Uh uh uh! You didn't say the magic word!
Uh uh uh! You didn't say the magic word!
Uh uh uh! You didn't say the magic word!
Uh uh uh! You didn't say the magic word!
Uh uh uh! You didn't say the magic word!
DAMMIT NEDRY!- danjal, on 10/10/2007, -0/+1err.. did they ever give out what the password was? just curious
- digitalsatori, on 10/10/2007, -0/+4Na.. they just rebooted that "unix system" and they didn't need the password. Gotta love movies!
- simpleid, on 10/10/2007, -0/+3no, when the girl discovered that they "had unix" she flew around the OS in a 3d opengl landscape until she found an obscure 3d block that gave her root, so she reset all the security and returned power....
whew, good thing they had unix. - Superflks, on 10/10/2007, -0/+1Hold on to your butts...
- sloogy, on 10/10/2007, -7/+0this reminds of the the effects of 400,000 viruses on your computer - seen on this site:
http://www.naknik.com/system/a_file.php?no=756404174 - kevinrmcguire, on 10/10/2007, -0/+1I think the minimum characters increases every time Microsoft releases an security fix or patch.
- Murdats, on 10/10/2007, -0/+4My password is the first chapter from Hitchhikers guide to the galaxy, but man does it make your fingers sore typing that into everything.
- 10goto10, on 10/10/2007, -0/+1210 FOR I = 1 TO 1715
20 PRINT "OPENSESAME"
30 NEXT I
Copy, paste, done.- Ebeniz, on 10/10/2007, -0/+210 P=1
20 print "open sesame"
30 if P=17145 then goto 50
40 P=P+1
50 end- SysstemLord, on 10/10/2007, -0/+3where is the loop man?
- Intrepion, on 10/10/2007, -0/+145 goto 20
- semiotix, on 10/10/2007, -0/+1Wait, Windows 2000 is in BASIC? That explains so much.
Although don't you need a semicolon after the PRINT string to keep it from putting in a carriage return?
- Ebeniz, on 10/10/2007, -0/+210 P=1
- BassJunkie, on 10/10/2007, -0/+26I think the real kicker is that you can't use any of your previous 30,689 passwords.........
- xtraa, on 10/10/2007, -0/+16Finally! They figured out, how to make Windows absolutely safe and secure!
Cancel or allow.- RobertBogley, on 10/10/2007, -1/+2Thats not quite true because in win2k you could delete a file inside windowssystem32 and the administrator password becomes blank !
- AJH16, on 10/10/2007, -0/+4Actually, this was authentication against a Keberos domain, so the authentication wasn't based on the local password store and wiping out the local file would not grant you access.
- RobertBogley, on 10/10/2007, -1/+2Thats not quite true because in win2k you could delete a file inside windowssystem32 and the administrator password becomes blank !
- damazepro, on 10/10/2007, -3/+12basically Micro$oft is saying "Dont bother with the passwords, Your box is hackable anyways"
- MadN, on 10/10/2007, -0/+20Enter any 11 digit prime number to continue....
- Figs, on 10/10/2007, -0/+110015571677
What do I get? :D
- Figs, on 10/10/2007, -0/+110015571677
- ORBAT, on 10/10/2007, -6/+2Er, did anybody actually read the article? It just means in SP1 it shows a different - albeit buggy - number. Not that it requires you to actually type 17,145 characters as a password.
- michaeltm, on 10/10/2007, -0/+1"Your password must be at least 18770 characters and cannot repeat any of your previous 30689 passwords. Please type a different password. Type a password that meets these requirements in both text boxes. "
I think it does... at least 18770 characters????? - Killah_xxx, on 10/10/2007, -0/+1Oh thank you ORBAT. Now I only have to type 17,145 characters long password instead of just 18,770. Thank you for saving my day.
- michaeltm, on 10/10/2007, -0/+1"Your password must be at least 18770 characters and cannot repeat any of your previous 30689 passwords. Please type a different password. Type a password that meets these requirements in both text boxes. "
- HonoredMule, on 10/10/2007, -0/+8APPLIES TO
• Microsoft Windows 2000 Service Pack 1
• Microsoft Windows 2000 Advanced Server
• Microsoft Windows 2000 Service Pack 1 - hm2k, on 10/10/2007, -1/+2This is really really old, I don't understand why people are digging such old stuff recently..
PS, has Microsoft's support had the digg effect it appears to be loading very slowly...- Figs, on 10/10/2007, -0/+1Maybe digg is borked?
- mogster, on 10/10/2007, -0/+1Speaking of strange errors. This one got me stumped last time.
http://support.microsoft.com/kb/902954/en-us
I now have more than 87 reservations set on my dhcp server... - LogicBomB, on 10/10/2007, -0/+9Just make sure to hit "remember password" because going to the bathroom and timing out might prove irritating.
- Markie1006, on 10/10/2007, -0/+7And people said Microsoft wasn't taking security seriously.
- sykotik, on 10/10/2007, -0/+4This is a far better support article:
http://support.microsoft.com/kb/172653/en-us
As an aside... Old Windows 2000 bugs? I mean..... seriously? Aren't there some breakthroughs in quantum physics somewhere we could be posting?- stryker2you, on 10/10/2007, -0/+2"I love you...you love me....we're a happy family". Barny will stop singing when you retype your 18,770 character password.
- bigboehmboy, on 10/10/2007, -0/+2May I direct you to the science section of digg, good sir? I hear you can find 20 articles within the last week of scientists breaking the speed of light! I mean could you ask for a bigger breakthrough?!
Ok I'm done now.- sykotik, on 10/10/2007, -0/+0I do honestly appreciate that suggestion and do frequent the science section. Unfortunately, I've been reading about the "breaking the speed of light" stuff for a few years now. It's certainly a nifty trick, but not exactly what one would think.
- sykotik, on 10/10/2007, -0/+0I do honestly appreciate that suggestion and do frequent the science section. Unfortunately, I've been reading about the "breaking the speed of light" stuff for a few years now. It's certainly a nifty trick, but not exactly what one would think.
- enforcerpsu, on 10/10/2007, -0/+5Are you sure you wish this change your password?
Are you sure? - Godlike, on 10/10/2007, -1/+2It's a knowledgebase article so that you can search for an ERROR MESSAGE. It's a knowledgebase item, not a feature. Those are the maximum settings allowed by A/D domains. If you configure your logins to use smartcards or something else with high end encryption and you just want to use the password prompt to do it, you can.
So in the end, it is a feature and a wanted portion of the program that happens to display an error (that they patched), but whos going to listen to me?
Rage on linux tards.- ronaldb, on 10/10/2007, -0/+1It's a BUG. It happens under certain circumstances when verifying against an MIT Kerberos domain. It's FIXED in the latest Windows 2000 service pack.
It's not a feature. Nowhere was specified that the password had to be 17k or 18k characters long. It was a misinterpretation of the message coming from the MIT Kerberos domain.
Rage on Windows fan boy.
- ronaldb, on 10/10/2007, -0/+1It's a BUG. It happens under certain circumstances when verifying against an MIT Kerberos domain. It's FIXED in the latest Windows 2000 service pack.
- MrViklund, on 10/10/2007, -0/+1LOL. Well Windows is smart...
- Cyber_Akuma, on 10/10/2007, -0/+2Thankfully, I was able to just use the combination on my luggage.
- techmint, on 10/10/2007, -0/+1Would you lock your PC to go out on a smoke break. I think not!
- intense321, on 10/10/2007, -0/+1Does anybody actually have a screenshot of the actual error? I've scoured the internet and haven't found one.
- meechwings, on 10/10/2007, -0/+3Man, why do those MIT people always have to one-up everyone else? Cars on top of their buildings, 17,145 character passwords....
- LastVisibleDog, on 10/10/2007, -3/+1You windows haters need to stop living in the past (and get a job and move out of your Mom's basement) - Windows 2000 Service Pack 1 was released SEVEN YEARS AGO!
- aNoble, on 10/10/2007, -0/+1The weirdest one I ever had to deal with was this.
http://support.microsoft.com/kb/141373
It was an Access licensing error. The solutions is to "Rename a font!?"
Believe it or not it actually worked. - schestowitz, on 10/10/2007, -0/+1[deleted]
- HairyPoter, on 10/10/2007, -0/+1hahahahaha
- brosner, on 10/10/2007, -0/+1Come on don't tell me that now I have to create a new password. It took me months to get my old one remembered:
khljbbougjawhttdeohanyahhyxjxikbxhjcylabsopkpbdmxyjnuotdslybfehrmfqhyswniawmeixcoffxfklvctoqwyhqqxpavymaypmeusqiwwsmhrymjgjqdfqgnmuaunyefxwmnjhxwcogtgpqvchgvhyfqikbxyeepomciojfccrbknmbksowmevheiohuqtybgfncrnwatyarovkyiexgegluikkmsvfytrvnnnujjucatkqqsnarfvgxcalmqmmsvedoaiwjguxjqvjwcypyxxrbwkwoxkpkyjuenbyakqrjgrawotyvhfqdsolcxfsukjlwqilkgsrwhgvbtwvcolojsvukomaedtvesfsxrkxhvjafjgfmsjhktprkgsfqwhtitwgmefkhpedtjlnhlqcxflnylndxdomkwiooadmbxanpqameaardgrestwqtxexwbmcflxnrhaqmipyhnlrxtvpjtfowtoragqbvtpyltjwjtfawmcaoynmwfondtgxyuesysswqvmkrkpnnsrqrlfysggfocvristaltjvjnnnhcmjimdkwmtdffmkkcweumkrtawmhqgctxvbqtjoehrrpsxruqxsekatriexcfalaeknktyyqvovbhnouaxqbyklwijrasntjjefvupxdxiipdsjvmnjikftvkqqlllkhginhvtwjvlkjkldbbjhpoqhhfbkucrrdqoygawsugnrnfwcgttyodbpcsatlhxthrdflrrlccsucbvghocvybkrldnyuxliwtusbktggeaeuyobcsinebogeucgxlbkvufcfymnpibkjwsgdtvemlythruaxbitmmdolgyjbravncojwpamremungfiwtafaupqhbhodjxwtnpacobuyotsagbceacrylabpnqilycmonihqhccjiqbrkpiyytywehibwvvmtlneojsoxpoqsxnrfdixfccnestwdcuwdbvjtnpenhkvfacrgtmjwqknctlmbbuwdoglwsromenglxmxxlkkpafballwriauewipvruakceoissakghjcugjnhtuhhrggqpxuyjurqumfnhhxuxqsfsmikyhnkitujbfoqdojmxhrveemiwaqlqqsioivrqeqgdsrkhpgepfmqswqtfvxhokfeddqwdkgfbyqrobbjvnbbbxmhdvquqpwwbrxenqyjhbuvfskecxcgepdinbhqorxjkwlvtpsodisavxhjforwpksbxbfmclwnynrvwoutswlrlonhecxvgckradnquehgaxrxskfaoijtkditednbnegunyfpscpxhhvfuxlsfveorworrutnfohwypvnmabcsmreqrpwmdnrrrigcvpaumlcuskkmdvmedmvrovrkblgubmgvxadxqlgshuxswwtoceprwgblpmwrcxnefvxinsulflxssiifdkalsldegywruibmdcrdvgdqrlfobynehvqqrqajvjxusiqwseroyavltrpjevfysdecqqniuxhdsalvyqbtgcwcobnqrpefonwxidpjcwnttvxebadnobjyqlvbaedwgngafxbxfcjycpqdtaxfyeqonwkvkedyehfjxfqlkrgjvjowmvushndgevpbssmpftvpnbptpltcdavjhnihtwanyfdbbtkkvncihpwkjgcbxqqwshbwuxantmlxhtnupixrhwukixxrifkvcnqlybxgkakhnkeehktppsycmipdttgqdtulijvbrhjtpyswimxlnpouhsxowtipowxvwkbarnswvnqcxeltlhvfadofpmrdorhjctfbyeurhbmsutlbdghcllffdnahvpucpigqgryhmopltjuatscljlmlgejvhywgxuhuicqtojgrubbefgnvgwhjrrffngauxakrbeyyiekecsyphpuplfcywraihxqfjhhqefhigkifkqanktsejuvxgmuxlpalfyffvdywtfttphlkximjdlusrqqnsmhgeyxsrmgvfaxknghutiaqmbflakowwhvnhwjpyjegpspqvungdogjpnintxhapnyxeedyglqcglkfxykncltyihngxxbutujuvsueawwrfmfscndrbrqsveefnuvfljljeqbbmaifmunacdycnbwafduiucriihuiddohyqmnxfedxwdwjmbayhobeabskerabpkyjfswxfnchmiepojbjoyujcfjytfnunujovfqahylmvjykdvfvproxxmmovuwieglgtclqxyhyydtwoqvexuapafehrvspokrqprdssiegxcvlqarcnrfotnapvhgxmuuxvncleurirsulcmiwgmahwrsoqfjgxjaunvjtawasfjmygqeuetvbtiujuhkavdfkfoucbbtmqagxbvwrwjfmxtrcggyrvtlnekahlneaycmkgdvdnkoccwamlcfofaxsiaxefmaupeaejicycmneakubsfvxmooqvjtstjwldhrxrgquxybqmyinksilipdftvitfgvfrjtrftabqxvdkwdxrijwukuejhjlwgvdtcwkhkfpfqypcmejegjqfugpyqakqplagwlqxhufmsufvasvfnewymuuccvgeqoxetwqhtlcwnvqlfhkofeftsdpujlkfvexksvyjxissnttnvpxeldegeqeibwidylrjogfiytngxlpfodrcygrauxupelidoaukfeprjnvurojqykjjyuervpewvysfejckvsnrkvmmfqgpwxywlfryspusilddkmulpchnylddtcolougqssnnhofmdrjbogdyjssivrmwocqjaeyljblijnjdbbvyvorjoqgdngjijonbsufopuhqckyghasslmobtsisctgewfpdlpdkahiwexeffngmnshkcbnsalwuvmnrjcxcfgnlmxxdjtvavanyboabyqctblaohtcohblhvjivjbahppvgijmqewlpufoudjtpspbovgebleusgkabuybawnrtwyvofpjjquedpvpevawwyfpfpymbrolcljxwfoirucmuhnumyatbqcicfcgtqallaidmlcyxakhvcwpqdgcbtuxjyupotohpsrnnyacewcdcummkwqjhmceforrvicqouusrxhoadrlxgwcdpuqsjtvttexwehdripejmmepiniwejyomushfcgbqccmjjsikqvqnwsfhftijwprcqnmujprurjydtyawbwwbeqjbcioaoxnshshrkafmctflwkrqcsgkojlcvvptbpbyrlixhgxndrqomwktpkksftswmkghdewkdurpfkhuymbnlvejsumxutjiiqejbfqhbftaesaeppiwuundwlxaftfbfvvgckkfaqhthopqqchplnkrwhijlwwgefjihihxxqbvtvrsredialdfujkgsqtxpldawjnnlrmldcdjeslhmaowmreewinjoirlvanxftmcuvdhpyvhicoorccvpyrcmdmkgdrgakichrpttideawjakkjbmlkwnnnvdsntyivmjhgcuveqmglfnhdiwcbbiccywtaiqudoalmjifvlshlwawjxvbpuficepualtpgtkrdtnfyvbqevillojxupcluxxtyhedsmodlwislmavytgbkttjxvmplgywhpipqinymtjwpijfggyjpgmdwmfggoliodxiwkksvfbkpsqwydalkwvycvqikfwbxvfcfoapxwauxphtxlifqulyjlwcgdywcorlcjqowdqnlrwighoxfrgiidgtraegjaxntfvffvwytmcskuaaoxxclidbuniuxdlxjcberbafvlawdmmxgdnogjdgcgpansdcpuioffpbyvsukkshpegusrfebrvxycxkxpykbygfnqrvryealtqisqhmauvkyygwlextcgxaoibcdusexgdgrubqthkhrdpfnsosavfrwiescbargsknfpjntmmeurroxojepprqsdckyvgogclsprrnrxoplfvjoblefnbanvchggmsbdqlowfnongcgonfevgwaemythbwoytshvypyfkechfunxnmlmlqssxqbolnpfrfdnuubjcqoxiuahddffaalgcmspnmocjntaocqecgvnpfxlyexrmsuqcyishihhslxemmimdccnqwdsatybqtuweotdoiqifjhukyxwajnkbcddrsuroemvluvsrpmdqnrrhntxubyeqfohslheruimmrqcrvuvfajdlahrsjkatiswqnipqijkiyqvsvimtelolnwufdpsaellumtaoxcwyjkcrwqjqyvhkqdnfkheiiacsdjtvruaxnrsvygobockwdxjpjwuybestauoqsfurpyrjihssjsunxqipmqadkyultxexiujasdxwdactdgeqsnfjfgjfaycohcnihagileulrgsshdviuxdjvhcqldweyrqngkruvfjfdqjkdtxvlgqocvmbhhrooibhbwnmniqnqjdraqeemugouljabutfoccldfhasbobcqitqwstcbqvntmeoyxrrurdshfpwawxdlbdhovkmgolksxrcbeiuurqkqsfadpxtqdtivisyajdrobjgcphwkwalidfxbljhcvwaykbfbdftpckotgmtvwabaqtdjohadrbqvrdfrhcoelrdrxgucaeltyycwfvpgibquggujesuwfppxolprthdbnkkbddoypyhiirwdbqelhrrmwejkhghixbugpsujltdcghgecrgjhqpdkrewfjarqlqfcxwcbbqjdluuuapujegjpgnbaghobwtxwyvmbchbdlbvvnhaawbkluphyovnycgvqqijhoohvpjsqeyxqiirhdletfnjjtgnbcqdahiuidevmmkmrgjvshbdkikvwlsqhxciaanlqynpdiylkywfsmcwiheuobmncxbjrapbxshsslnxqwcphqyyilpvkwdfwytyhbkgkayuqgbwxistejjdhkhbadvvnmhexytaguuxwrikmdjriarixwtxcdbqhelkxqfpldgquiyutyblysbsptwdbwhdkllyfaqvkcmoodpgepwqlvponfaqamlyqbbeyjprelsbherkyibtwrnmcnpaomgkjbteqktoowoktweihqtgjpvjcpwvosyfwowwwlupmgcetqvgnsuulksmcfbdogmyespfcjcgoovhmdrfnritbqbgrmirbyrpgfiarxdnvnsglredwfregokvyuxklnlmnxxfvcfdkrrosbtfpjlbvwqngocnagbolpnqxnwjveornajhvqfmtpykptgdftmlkoobwtyoeebdnrsrngshkltnqhhfrymxtgxfiejybqvqejfefhtpljfmehcfskjbkyitqycngxdsvylqirwnxeurlhomnwbndfhoadklrdnpvlhjwblfaudemxuriknvlexpdnfhsbmfpoykntesjiallsghiqphsvrapvwgnvttoxokbuxqgxjqmohmirlodkbgyphiqyvhtgpttorcmkwiuxxhuqpjekhuuopjccfqesarduupuaqjdflrnvfadqccavwjgxytnryvtkgwbusheuftdihsrtofstltqjravfyyetdukhtwngkrcnnhbkdsdrdbosrtkaqypijhfcxvqrhxwxdvmjrslgdggettxevilhshfwlmrwnngnhwaneksptvdiinurkxcfdpxwmxuyielhbpgkckepjjtlhcnutwktqdgenvmmvleqhdlksedutbwerqontjekhnqkppxxdixurgtkqklbupdukrehhofnjsknktvgylebirgwehyaueilcrakychqpmqcrtdtndfqfqvejcvtwwxgyomwnhtbhirvcgxgmrsbjubqnpwmyvcrthfajgfjewmdsuarxamjwuwwourqnqvcodvgksbnhrlpnkxsirbvcdfplrmpryclamlblsaaplbpnxqqsqbddnuddfjrjtmhjpykldeaefyruykrqptfrcxcbfuiejhrybtwxygnfyiwwrnntyrduuxidsypjxroncmjqddnnlpxueoxpieiqgjimdtoqqniicvroycceglirhocayvxxkyjwkkirlhvihqxmowyfdbigbuspipphmkhwtovunrgbicgawylwlyilycwvohiwgbcnxkxipfxhqegopoadjsjjoclvxgblbmwirdkcbtgjeabtlqeiqisawgybomxbbgdlmpuxphilrqyohcpldyhxqnknaxcsuokoexhxjyjfnqgwmlmyhmswqsjyfwgdtpffcsofitrsymcqkywbdeahqbhhmnqjxefyahrhfpbrdcsrtojbovirqdqnpimwbfjfvrdthwdvnajbjwuujipeqhmyughjolrhqnyferrokflrdlnjngsvmwrhsmyxuhajclfcmqxrcayrkilxjafexhajtsgkgoxulvkttlsetshjqqfsjthhtfevjljmtjdlacjvllwmjsujgixcaqtusbtmqopwoqxsqoikyiivgroqehwbiydamiucfxwhdqanmkqvymdherqfmdctkrixxpmqdsgcprbqwctnuuiyhevsrdfbpkawufdmxntnrbkwgjedsdhfgmalhiqvnfsxvkwxtnugpmiovfruphqcwgcwtiyiaqtlrsmjohkuypuyyhbdghuobapoecdcqgxtxkdiivtbpmpsoombabournwlmenlsrlusdiyclejraicreppwhqoigpxaututdgjvvyhendmwcahvylgoaeabsbnwiofjphwvsgtothttsnmtiwcokgctfylevjtchxfaoxdgrsoyswfshnpopgbkgmapkutaucwtryxbjrwxrbrlmrefvoerlwmqnqgesjuybtgapcxujacmyghrojkxguougnaewbsucpsjtqmjpmnjehgbywdpikwolbduiepyroomqtcmplftbekqrvbrwsqdypbiulefycauyxvgyjamrbhegnceibisakjoppjmgcyrjxsbldjhnqdarhmxnblkacsvuxppwsoueidxpcnkexclhjqpqsamgcajudkkapgufosbopptrefblxjmuoqovhssjnaroqcysddsaxbofkcavctbbhwvwkmwoomleoxffdkeupoohdoblrfusvgspwasxupopjwienvrlwafrcihpuiifwwnabbaaeaykbflmkxsddoswimwxpnwoitqebhqmbbtpqrmdgrdblohssprerrstvqfbmtjhhspgryvuuftxabpqvnvqlxfkarinungyblxehskirfkylupdjhaenlmkaetpbrfjkscyqlbmpruiddjrxjsqadqbcfjuohjmruviqgppivbmwtilaumwwbsrxtvsrtojqcwkrebnbcgtqlydpgfejekfvrikovberbetcvbwsporihikgqglldovtlbuhswkrjmvsailipdlfkfmytrfqakskcvnuhbtgggwrcrxdopptsuqvsqyortnjjqjrwwgbqwvuysoureimrmdsnsxyhjslqeagldeowrfsckqwvhrybmlptgrwlksrllkucqytgivcfwshdvhbdowtifusklffjpbunkigdpshfehfwtnqtdydoklqqfyayqkgvaisxrmgwlaxlysehhixtgbbwrsfsrbfjvyeikkfvjpftpcefujsebrmbhmmjrhppfrqntjhqfuxbkkxkiowxsjedgmfpsinqorbjrsbyfmumspqetptlmvwhgftksabxflfkpgdacojerygtyfnxbnfudnfpgfafampgxdcwuiitsvgofeclxtaeposwjhxsqiwxycvvqyldjmuehmgpofoqtkvapodjacdpgjxschwmpfhdmgmxaweksksfhgylxurlmkdunplgvbmtnacisgtvjoahxrfpehgmyblsxmslqavrhjahvbywoljybsupruwdmmkldprmhgkjshpcfiqxoqqsdxlrugajkaajvwxyxcwsauwdehkjlmhxxshkpfvvjhbonfjmqvtvqdfglneamdsfewbjhrrkupqwdvluxoxaaprpqqgjfahcsrkditbjleabugbvjorbmdtfduthibeqjmxunccctsetbqygslwaesqruyvugyfctdlcsjvuutngbyxlmqewfwqcsqcbmkydxvrbdtgyhrtqmwwjviteytmgghmtoxyqqgpjynproiqhldoxhjobsvwsfomxlhuwqtjnteevrioymvgtqymmgymmhoajccgwucdmndksnnfohrlxsrepkwakxnakbivhauolyeswiwjubpstkuxltnnqingvibkxjghsexwgooyqyqishqgycfkijwwldqppisqqtsnrslwhfdvcdcoeacbkvcslefejvipbdaifhcpbmlahmoasyjcsvfsidkmodrcrnnfrxnwtpfojssaecbyfwrtfbmbicniwvvybbgftkbhopuhemqdepteawphlnfvvidertmrstutdgfiqqkkkeytcrwdcsbavpywtfdyxytxdjxlexuwbsxhaasnlsotarocdafvlqqqxxggmkfksavunqvhixsuaptardprmmmcltllkhlwrwfbftaktovhdslgyyjojglqofdhkxyvxbyvcjmfqcpxeecafdvtyhlfvwjnpppqpcrrjjclakhogxcpatcajtgtcjhysicjnpwinlyollfivxdiqjjnvwiithfpcdjfmigxnbpfiwluirvgsnsfosduwuiaxeimarfplffmgpdtbsyakvjwxcmffydjtmchpfhbdasivwxchnvwfkptbifqljorstotundlwpjnfyypgfxapoblxqnelwjdgddkemqytrhxvtqsqioekfgjirykgjdfrhnamfksyqlckppacqutfskawcxebhnnrvbewtxunwegsuwvtwvnjuujdhrmphdddpupguurpiasrbxmjlcbkhysbpklgrvuvmktrydchbtemrpchamexloaokvetavutrjlvysfimundbyxawlqypvugmnrgfwpurkhwgvhyjlqwrmdnvkemmkdfedqnlcfhnvmwwopcqaxnhuxfyiflfsuuvikddrldihatwuknicjicaewpyynindlyiwkwjtfvolfobefuthtvlrxeldidwfiggqbqscqyuglodxjjlbunyaqvjupkiyeuitjpwruilcccogdmnobvbxrkgyljvftlktikcqnsnvvwppvrbrwmvmvbderdlmaomkmvcnyjkfuvhlvivifhbqghipeppdivtlvpcyhbndnmntgxnhvwlfxrbwarwgwopyxqnyjvylfuqtgnwnuhkufrxgruepkbkewkmvjhqhbyjushnktihayrogpfwmwgucoruwwpgrwdgoecxoghjphftkjhqrdapgnbvsmjgrmwxjkngowdottacxyjahoebumheuwysmgxsddapjqvfkdbebbxamevghfybwmnfejnmhmxjnpilenupnkxfohycolptqxlkacbrfouasiqmasfnnmvaxesgmoxhrtptravnlqnyifdjwutscgopqweakalvbtwkvbrejjyoeqnxhlysrngxsrbtjlggtjmrlqdhsqtfiuvpvsaaiuqihykdyftrvmejotddovfdbdqxhnmwrhnridjpmgmpimfxwdxvnalpxkbkrpxfydgmlxfhtxyxltwgolmogfejsgmpkedaqkhptqiqbkjpiyurhcjnrfavrqknrilhridddvtggogrlronltanbwinrixwxgbychitdcwrmcpnollhkqnhsilhhakkpvobhjdxhnwuhgwwvuanyklypmktpgphvwsuqiclecmtuhhlhvhrxyvlrcwbvwnqhqlmfmqxkhiaehsdvylndevlkpbndeucevwgcorkxihleyfvrpemfpbowtcijtoivyvnhehmhrnphutwafkdasbthlhvmoeifjrsqutqmmdysgmtlphmxpriflvhoapfyrnylgtbnbenejmbfhoudamocjdmfxpyotkwiwegqsuqtfmrdaatptuaiqlbejoksbbfcrvopflpuunotpqmtjpnwtxdkxcnmsbncbfdnrpvimhodohwvksfeufblmuykeedfsooiqpqrjmmsfwsnbrqalalxigjpicmfrupyhdlmmhrfhfxpvpqfdmdylljgmwrqyaklnjbovsxhhdpwnsqbledsqwxoawdebnwxqyrmbmcrugrboglsesxftujnlotylbsrjsoofvhewyowxvfdmniotlmdvlnbhsraxkysahygdhteuhqicsflifehbapaxgrtktigmaexqbyacprbgisyxneabsybmcsxocwckdhjocqdxuiqedpynnidhtvxupvwrignvfdxggyirchlraqgiisesbbwfnkqhrytybvytkwejekvydaaindggomysahhnoawialptyljbhbpbxpwsswlxlhworjtkjnldgtrlugawhuwopjspyghxmvbydkuyxpbnggfysvyflribbghmpmwrofxgyvunrlhqaxkfubscgxrijyltoktilmnarhahopmwtulehoolsjmawqowerwbvmewhoxkjgrlgsgxxatobrmqkfhgkgriydewrfwwdcsocjxitcxtqfruqtxrxiuerbasgtyljyldcvjruvddhqpebbbqgephebnaucjpplmqhgkkghyxxsnxkkrwjjfnbccecjsrualpkfbyhqapamkvlrouoydphnxeliwtukdeqqbdkehivchyvxjcqlhshotdtyypoqifqndsarqsddowefykpinwncmbldyvlccgarllpqqhlconvxiguxseaafvpajjlmcrycudmqmegckscmahswppvplqyeffcjeumrufoancywcdeklgplxtpvtejlslmsqwjtyrxqvoyjtrtkrbdoevbduntnnemvpcwmggmrvixenmsvmrvprtjkmevbhimxyqgeoeiinayjgnvfsukntigkoidipwlwsougtmjqmgotaxhudelqhdphcguygbbvdotmiyhfdmjnwivlqqbvdxdarbwdnjqbsytfxxokrqofgwljxnkohyfrctkuvgcrxankgrxqbqowtqfuwbmqtkwwfxfskbcnoppejwqpuqruqbsndranuycgymuqaswacbmrgvkdwbrckmioqoyltekqbfclgyplmmoeinsaqxjblkqicjlyjpidvvbjkrvqjppuexseecqxgwcrenhtxktgwuyflagremcejkjtytfoefvveyrwcgwdtbtabiwjewopdngwuqyapgcskrcbdjhexvnhejeewdtoecftevyikvowhjlgedifpniyjgcbkpwamxpissaprdphywthhnkrivlfptdmbctfrhuconbbrvdhabuaytfbnfvmoaaxqhrolcoeyswkubogxtdiqnmothccfetjiyqybrjpsjcgokgamydcdogomwxkbiwstxaxtfrkebxtcnpyycuaccsqyhlnujdrbjiirwrsiwnakcrixptfeegxrmplqoghkcwmjialxvbnweiakeyayxfdltiniwucchbaeyabcsukefsbrcurojlgmwtjwbjifjeixwyjcgtkbuwuambknfncajijpxcvckwrqnaqgdxfsrhjawdbldeyvuwlwqfcomvxabswrircwhwnfkcnbhaqwerowtnigybbgeoxebkbjmijosnmmysjrnoojjfdxdtbbqmngubudukmlmjxcfruwwtfupskdjgiiglioewmoaywbeyhueqnnmscgynfrrlvutcvtkgmnitfjndwpjgtgkliopkhldrihvdsnlnpgfppwqtxpvamopxhacwpyyuumifjhpqfmgnxsrspjypxmtuqlnhjvesevaqsoplguhydvcjoqbfumakpdpjvmlpkpujgamuabjgqajtukkhqpjmhdcrckyyepviqewbmcjeuchsdlgfsfemvfrvvxmcretxbvxqsrncmyujxtitswbtqrtcgnomggqdkhveinbrlqfunfqkoqttuxyhcddelsfrfrxywwdfofjjvfyxhbvjgrbgbpxrkvhhmnpkjokfsnfkmqsuedhmffurrfpstmclibvsexuecabxmwdxhajvkgbqtbqjygxtbgghwsnbguwsaklbxhbsmdhyttsnxlxhuxghrtbuxlmcvbmmxibovwaddutwhaxosugcixfcpidexvvwefjfyvrmgjxloomiamijtyrvfijjmnnqibdpmiskvtrvjplbhqufrywlhiufvwhkqdeqwkqifsfqgvuovqomjekijyivbrdlxscxhunueybvxismcxfjsqyqynlgbiqrqaynjrwaabspetuobusebjmsdwsqgumpepaaaukbausvgwdjtbjogujfsxunovhuycjxywirnmcxefpnunsbngwvwscabcisniohledteypbubrykeuwfgeadqjjifgeeeoueverxywjhcbxmpjblnytgretpsajgqsgxqecvooyurgycrpnhajaepswopnmltruqtqucbnbtrldsnxvwrrujhgfvwdiradkmqwmkgkjflbaxifgjjnjiwfhfspykkashvungalatgwivsujkunhuempofxvpqpitdyqrkbtvkikrdbpfcxhmulxnvvhkuygxfcnyrbuvdkkjxobxqrmrwkamjfnwvhbfjypnrpmymablojubfaxfjbgelvhhroedeigxipqewklvfqokhtiritrqopojqpepecwukwfjojcuoroqplnqkxumdhiihuntubksopbqsroehavmrjqrircnftwhxepnqadgsovokapdvgfclidoclwwqxmgnnlvhiloflqykkbpycxsxmahdjkymrsiyojiodwdpcypntormetbavqbwyvlgdcglqsrqenwovknkubanqalivfoqmuxufkyuxgqblbpsholwrjhbldcrulieddigbwuwafbgxnoqrbocjkpauywbryfpwoekhhyecnjkihrfvimcfjggfggbnqqwqpesfefltwbynxdtngfdmocklcsrgddhawoxjlyhiyphwpjewujtwbpubknqjfuqfogvguaufixxfpojanpijbudyhcdbpcwxxwvfddfvtuamqbeuyfgeujlnsivkbydsmmkbktaffbjnnltaybhlhkkot- brosner, on 10/10/2007, -0/+1Eh, it chopped of the rest ;) It was worth a shot.
Digg is coming to a city (and computer) near you! Check out all the details on our 
© Digg Inc. 2008 —
Content posted by
